McDonnell Genome Institute

Washington University

CircRNA

chr17|31431812|31528778|+|RAB11FIP4|ENST00000621161.4

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9456

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

2

Peptide

QVEKLVK

Amino Acids from 5' Exons

VEKLVKYLDPNDLGRINFKDFCRGVFAMK,WKNLNIWIPTTWGESTSRTFAGGCSPK,GKTCEIFGSQRPGENQLQGLLPGGVRHE

Amino Acids from 3' Exons

LIEDLRKELEHLQMYKLDCERPGRGRSASSGLGEFNARAREVELEHEVKRLKQ,SSRTCGRSWSTCRCTSWTASGQAGAAVPPLAASSMPGPARWSSSTRSSGSS,HRGLAEGAGAPADVQAGLRAARQGPQCLLWPRRVQCQGPRGGARARGQAAQA