McDonnell Genome Institute

Washington University

CircRNA

chr17|30443801|30449748|+|CPD|ENST00000225719.8

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9304

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

6

Peptide

NPAVTQVHQGVR

Amino Acids from 5' Exons

VHQGVRGFVLDATDGRGILNATISVAEINHPVTTYKTGDYWRLLVPGTYKITASAR,FIRASEDLFMPQMAGVYMPPLVLLRLITQLLTKLEITGVSWFQELIKSQHLLE,SSGRQRICSRCHRWQGYIKCHHCCDSPSDYLQNWRLLASLGSRNLNHSICSR

Amino Acids from 3' Exons

FGTEHISSHLVPNLQAQCIARTKDSFCCWYPWKCASWNTAFGSGRISLPELQKEPSCYP,LGQSTEYRHIWSLEISNKPNVSEPEEPKIRFVAGIHGNAPVGTELLLALAEFLCLNYKKNPAVTQ,WDRALNIVTFGPLKSPISPMYLSLKNQRFVLLLVSMEMRQLELNCFWLWQNFSATTKRTQLLP