McDonnell Genome Institute

Washington University

CircRNA

chr17|28381202|28385275|+|SARM1|ENST00000379061.8

Cancer

Type of Peptide

CCRC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9327

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

10

Peptide

APRPHPHGGQR

Amino Acids from 5' Exons

RPRGAHWAGRDPEPGEGTRTRRAGAERGRHLGAHVQAFGGDMPEAGGGRRPGRGAVLVPPHGPRAAAPLRAGAGQLRAARGPGGAATHGREARSRVALPARLLQGGRAASAARLPRSSGVGDQGGGARGGALGHAGARGAACGLAGPWPLRPLSGGRQRHKPGPRARRPAAPRAVARLPLGGAVHRGFLPLRRGCHQEPARQDQ,DRVARIGLGVILNLAKEREPVELARSVAGILEHMFKHSEETCQRLVAAGGLDAVLYWCRRTDPALLRHCALALGNCALHGGQAVQRRMVEKRAAEWLFPLAFSKEDELLRLHACLAVAVLATNKEVEREVERSGTLALVEPLVASLDPGRFARCLVDASDTSQGRGPDDLQRLVPLLDSNRLEAQCIGAFYLCAEAAIKSLQGKTK,TAWRALGWASTWRRNANPSWRGAWQASWSTCSSIRRRHARGWWRPAAWTRCCIGAAARTPRCCATARWRWATARCTGARRCSDAWRSAQPSGSSRSPSPRRTSCFGCTPASQRCWRLTRRWSARWSARARWRSWSRLWPRWTLAASPAVWWTPATQARAAGPTTCSASCRCSTLTAWRRSASGLSTSAPRLPSRACKARP

Amino Acids from 3' Exons

VLGAHGAQDLRQLFYVRPQQPGGLAGQPGPALPPVHLRPGQLRPGPLPAAPRVAAAAGRLRHPPGRAPRPHPHGGQ,FFRELTELKTFANYSTCDRSNLADWLGSLDPRFRQYTYGLVSCGLDRSLLHRVSEQQLLEDCGIHLGVHRARILTAAR,SLGSSRSSRPSPTILRATAATWRTGWAAWTRASASTPTAWSAAAWTAPCCTACLSSSCWKTAASTWACTAPASSRRPE