McDonnell Genome Institute

Washington University

CircRNA

chr17|27770912|27779056|-|NOS2|ENST00000313735.10

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9988

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

2

Peptide

LAMETALAMER

Amino Acids from 5' Exons

VVCMDKYRLSCLEEERLLLVVTSTFGNGDCPGNGE,LSAWISTGAAWRRNGCCWWPVRLAMETALAME,CLHGVQAELPGGGTAAVGGDQYVWQWRLPWQWR

Amino Acids from 3' Exons

IRVVSGTGAKVVRPACSGQHAAGGRPGVPRVPLQWLVHGHRDRSPGLLRPALQHPG,YEWFRELELKWYALPAVANMLLEVGGLEFPGCPFNGWYMGTEIGVRDFCDVQRYNILE,TSGFGNWSSGTPCLQWPTCCLRWAAWSSQGAPSMAGTWAQRSESGTSVTSSATTSW