McDonnell Genome Institute

Washington University

CircRNA

chr17|2394874|2395454|-|MNT|ENST00000174618.4

Cancer

Type of Peptide

BRCA-HER2-enriched

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9319

12

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

12

Peptide

RPGGGAGAASLGAGAR

Amino Acids from 5' Exons

RSRSGFAWSRSESRNRRRPIAWPGWHIPFLWRNPAWRRHPCLCLHRLPRRHPHHHLPPLPHLSSLSLWPTPLSLYPHPHPCPRQPSLCPWRLVSRPWLAPPDSALRSLPPCPAGRRCPPLLPYCRTRRPPFHPMAAPSLCSPSPRLSPRHTLESSLSWPPSSRPHPRWGPSWHQLKKSNPVNRRRGPG,GAGAASLGAGARAGTEEGQPGQAGTYPSCGGTPHGGATPASVSTGSPAGTPTTTCHPCPTDCHPYPCGDQLPSASTPTPTLARGSPASAPGASSAGPGWRPRTQHGACPPAQQAAGAHPCSPTAGLEGHHSTQWQPQAFAAPPHACPDHSATPWSPASAGPPAAAPTHAGDPEVGTSRSQIQTEEEARG,EQERLRLEQEREQEQKKANSLARLAHTLPVEEPRMEAPPLPLSPPAPPPAPPPPLATPAPLTVIPIPVVTNSPQPLPPPPPLPAAAQPLPLAPRQPALVGAPGLSIKEPAPLPSRPQVPTPAPLLPDSKATIPPNGSPKPLQPLPTPVLTIAPHPGVQPQLAPQQPPPPTLGTLKLAPAEEVKSSEQKKRPG

Amino Acids from 3' Exons

RSRSGFAWSRSESRNRRRPIAWPGWHIPFLWRNPAWRRHPCLCLHRLPRRHPHHHLPPLPHLSSLSLWPTPLSLYPHPHPCPRQPSLCPWRLVSRPWLAPPDSALRSLPPCPAGRRCPPLLPYCRTRRPPFHPMAAPSLCSPSPRLSPRHTLESSLSWPPSSRPHPRWGPSWHQLKKSNPVNRRRGPG,GAGAASLGAGARAGTEEGQPGQAGTYPSCGGTPHGGATPASVSTGSPAGTPTTTCHPCPTDCHPYPCGDQLPSASTPTPTLARGSPASAPGASSAGPGWRPRTQHGACPPAQQAAGAHPCSPTAGLEGHHSTQWQPQAFAAPPHACPDHSATPWSPASAGPPAAAPTHAGDPEVGTSRSQIQTEEEARG,EQERLRLEQEREQEQKKANSLARLAHTLPVEEPRMEAPPLPLSPPAPPPAPPPPLATPAPLTVIPIPVVTNSPQPLPPPPPLPAAAQPLPLAPRQPALVGAPGLSIKEPAPLPSRPQVPTPAPLLPDSKATIPPNGSPKPLQPLPTPVLTIAPHPGVQPQLAPQQPPPPTLGTLKLAPAEEVKSSEQKKRPG