McDonnell Genome Institute

Washington University

CircRNA

chr17|2325303|2335730|-|TSR1|ENST00000301364.9

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9079

11

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

5

Peptide

KAMVLAEK

Amino Acids from 5' Exons

RTNINCRDSLLTWPWWRQSMRQSLFLLHLCCFSSKKAM,GQTIAEIPDCHGPGGDSLCANHFSSCICAAFQAKKQ,DKHKLQRFLTADMALVATVYAPITFPPASVLLFKQKSN

Amino Acids from 3' Exons

VLAEKRQLGGKDGPPHQVLVVPLHSRISLPEAMQLLQDRDTGTVHLNELGNTQNFMLLCPRLKHRWFFTSARP,FWQRRDSWVARMALLIRYWWCPCTAEFPCQRPCSCFKIGTLEQYTMNWETPRTLCCCAPANIGGFSPQQGQ,SGREETAGWQGWPSSSGTGGAPAQQNFPARGHAAASRGHWNSTLEIGKHPELYAAVPPLETSVVFHLSKA