top of page

McDonnell Genome Institute

Washington University

CircRNA

chr17|2040217|2040605|+|DPH1|ENST00000572214.5

Cancer

Type of Peptide

HCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9636

22

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

7

Peptide

TASGGGK

Amino Acids from 5' Exons

VPIQSPIQRTLPPAHAGCSPRSHSHCPLSVLGPYSGHFGPPGQSDPGGQWAQDSLWRREVTGNTAGKTSRPQVQLWLLDQVTPTLPPSPNSTWNLDSEPWAFPLGCCSLRSSPASLAYFLRWM,YDPYSKVLSREHYDHQRMQAARQEAIATARSAKSWGLILGTLGRQGSPKILEVSGLRTASGGGKLGTQLGKPVGHRFSFGCLTRPPPCLPLPTAPGISTPSLGPFLCEAAALDLPQQAPTSGGC,MTHIAKSYPENTMTTSACRLLAKKPPLPAQLSPGALFWALWAARAVLRSWRSVGSGQPLEEGSDWEHSWENQATGSALAAPGDPHPASLSQQHLESRLRALGLSFVRLLLSEIFPSKLSLLPEVD

Amino Acids from 3' Exons

VPIQSPIQRTLPPAHAGCSPRSHSHCPLSVLGPYSGHFGPPGQSDPGGQWAQDSLWRREVTGNTAGKTSRPQVQLWLLDQVTPTLPPSPNSTWNLDSEPWAFPLGCCSLRSSPASLAYFLRWM,YDPYSKVLSREHYDHQRMQAARQEAIATARSAKSWGLILGTLGRQGSPKILEVSGLRTASGGGKLGTQLGKPVGHRFSFGCLTRPPPCLPLPTAPGISTPSLGPFLCEAAALDLPQQAPTSGGC,MTHIAKSYPENTMTTSACRLLAKKPPLPAQLSPGALFWALWAARAVLRSWRSVGSGQPLEEGSDWEHSWENQATGSALAAPGDPHPASLSQQHLESRLRALGLSFVRLLLSEIFPSKLSLLPEVD

bottom of page