McDonnell Genome Institute

Washington University

CircRNA

chr17|20227412|20260294|+|SPECC1|ENST00000261503.9

Cancer

Type of Peptide

PRAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9996

82

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

6

Peptide

KTQGYAVEK

Amino Acids from 5' Exons

VEKDYSYLKEICDHQAEQLSRTSLKLQEKASESDAEIKDMKETIFELEDQVEQHRAVKLHNNQLISELE,WKRIIHTRRYVITKPNSAEPASCKKKHQRVMQRSKTKKPYLNWKIRWNSTGLSSYTIINSSVSK,GKGLFIPEGDMSPSRTAEQNQPKAARKSIRECRDQRHERNHIIGRSGGTAPGCQVTQSTHQAR

Amino Acids from 3' Exons

CGKKRPSGSLGPGIRWFQAQCSTEMVPEEDTRLC,VERKDPLAALAREYGGSKRNALLKWCQKKTQGYA,WKEKTLWQPWPGNTVVPSAMLYNGARRRHKVM