McDonnell Genome Institute

Washington University

CircRNA

chr17|18865468|18877870|+|PRPSAP2|ENST00000268835.6

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.943

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

3

Peptide

AGGILLSENK

Amino Acids from 5' Exons

EEFCCQRIKGGCPLTLSSNQNIELFSSAFL,RNFVVREKEVVHNLAAISKTLSSSAPPF,GILLSENKRRLSIIDFKQQSVKHALQLRLS

Amino Acids from 3' Exons

GREHHHHGAPDHGVCMDLLCQEHHWRDTLLSLQQAVQDEKKRLHCLIAGFHDVQS,DVNTTIMELLIMVYACKTSCAKSIIGVIPYFPYSKQCKMRKRGSIVSKLLASMMCKA,TTPPSWSSSWCMHVRPLVPRASLAYPTFLTASSAREKEAPLSLNCWLPCAKL