McDonnell Genome Institute

Washington University

CircRNA

chr17|1875660|1888851|+|RPA1|ENST00000254719.9

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9881

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

13

3

Peptide

LQVPACHTLLGEHSPK

Amino Acids from 5' Exons

VLLFLRLMVLQRHLEKLQVPACHTLLGEHSPKWCPLPASLLTSP,FYCFGLWCFKDIWKSCRSQPVTHFWGNTVQSGAHCQPHSLPVQ,STVSKAYGASKTFGKAAGPSLSHTSGGTQSKVVPIASLTPYQS

Amino Acids from 3' Exons

PDYFSSVATVVYLRKENCMYQACPTQDCNKKVIDQQNGLYRCEKCDTEFPNFKYRMILS,RTTLVLWPQWCIFAKRTACTKPARLRTAIRKLINRMDCTAVRSATPNFPISSTASC,GLLFCGHSGVSSQRELHVPSLPDSGLQESDSTEWIVPLEVRHRISQFQVPHDPV