McDonnell Genome Institute

Washington University

CircRNA

chr17|17724027|17798513|+|RAI1|ENST00000353383.5

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9543

7

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

5

Peptide

VAVDMDLIWPPR

Amino Acids from 5' Exons

DLIWPPRSGRGERESVRERRETAGERETARRAAPAPGRPRRSPQ,ISSGHRVLEEARGRACARGERRRGKGRRRDAQRRRPGDPGGAR,SHLATAFWKRREGERAREERDGGGKGDGETRSAGARETQEEPA

Amino Acids from 3' Exons

ITSPSHAVFSRKVWFPWQTTELPADLAGNITPRELQAAESGRAKLRPAAAARQGLLPAALPELGWRWHALWHCSRGGRRQVPPRQQGPAHTARPAGEAGFPWLRRPGQQPLPRPLCWGEPSGLGGPTATTPTAAATTCRGGQVELDEKDSSAPQQAVCRAGRPGALSDSLPARPAATAAPAAPGIPQAPKAEAAERHCLPSALPPGYPLSSAFPVLPHLLHLLLLCPGWWAGGPLLELHSTDCPAPQAADCQLQPGPGAAGPESSCLPVGPPQLPAAAAAAAAAAAAASPSEPAPCPGNPPLPKPRQVSALRAARPGLLPAGRSRPDPRAVLPDLQPQLQPLTRPLRGPLTFLQFHTVAADAKPGELSLQPAAAQHRGLPRRDHPQPLHAPAQSLPNGCHQLCGHPGWQLQAPSEGQAPEPAVGSQPAEPHGADLTGGEHLQHRPAAAALQGCCAAEERCQEPRVQDPRAAKPALQPRRERLLSRARRHTAVRAAEQHATVHACGAAGGRLPERLRGPTGAQLPLLQPGPWQPCQGQQQLEGQARVRVHLFCDLSRHVHQIRLLPEPTRQSAARQLLQVRGGAGLSAAAAQRPGTGGPGLRDPGAAGSHREGRQSLGSTQPGQGQQQATLLAGEPQRLPGLCGQECVAPAWGAGGPARLLAAGQGRQCQGLQPRAVRPFRGLRYAPQKDNWSSLLWYQAHPWGSCSRPHYSSFLFPGHNRCQLSGQRQPLCLARGKPGGCLSQVGIAPWRAYQGPGAGWEGLRWHQQRGHPGFGLPGLPGGGPPWGEGGLVARGLQAGGGGWGEGGGRWAAAVPRGGQGPVAGGQPALLFHRRLRGPPTAATHQQEGGPGSGGVLLPMAPGQPRAEAWHAGPAVTQGPTHLHQGGGGGGAGLQGRLGLSVPPLRGVRHPAGPYSGHRVKGPELVVLSVTHEARRGAWGASSRGFHHLGRLSGPEAQQACCARGAHRKERACATGQKLTEPSGAPGAARGRGLPMQGTSAAQRPLAPILHRAPPGTDGRGWSPRPGGLGRAPQDVYSFSHGPEAPHARTPRPDHHPCTPRQTGGQAASRLQVGQAGGEALTQGCLQPQQPGRPACGLRQQPDGLQDQGDRLTQHAWQGPALHDPSVTHQNPGDLPLQAAEALGPAPQLPCHQEAPRQQPLARHIQGLQQPPEGGQGEPAGKGPQTWCRQQALPAPPCAQKEVGLHGAGPHQEAEPGLAEPQQQQQQRQWQWGRWEGGEAGFPHPLQEDVFSQESQAHQGQWRACHKAPTPGDPRCLPQARLSGSLPGGHEDQGAATPEGPGPEAGSHRAEDHLAQPQEVRMSARGLSWSSEPIPFRQRPWAQGCWGQPSGGGRRPGKCGHRAEAPNFWGSVMQKSNQQILKRQTHEQETVFYLFQNRGLHIPGGPAAWGDCPGAEEEPERPGRGPWTLQRPAGEAALSWPGSAPDSPRQGQWHTRGQGQLWWRRQEAKDGGAGPGLPAPGGQALPAPDKGTETARPHQLQQLFQAEAPHSGPGQEHHLFTLGACQATTTAAGAAPGSRRANPPQVHFLLQAAEVRQPDPRLLTLRAGGEARRVHHHMHCCQLPWRCAQAPQEAFLLCLLFLILVLVLLGCSRGLPGHTPWRLHPAAAALLAPLLHDALGACGFQGPEYLLPCLLPLPKPGQLQGPWGPLWALLPTLPPQKEAKTQGEGAARRHLGGLAAAENTQRSRVCSCRHCREAPQARPSPGQAGPTAHQCPGPVPEAAELLLLWPGGWGRGGSPSRQGSQTVQQGGSGRARRGGPGALGAGLCRVDRRRLPGGREALWAAGGHEGGRGH,PARVMQSFRERCGFHGKQQNYQQTSQETSRLENYRQPSQAGLSCDRQRLLAKDYYNPQPYPSYEGGAGTPSGTAAAVAADKYHRGSKALPTQQGLQGRPAFPGYGVQDSSPYPGRYAGEESLQAWGAPQPPPPQPQPLPAGVAKYDENLMKKTAVPPSRQYAEQGAQVPFRTHSLHVQQPPPPQQPLAYPKLQRQKLQNDIASPLPFPQGTHFPQHSQSFPTSSTYSSSVQGGGQGAHSYKSCTAPTAQPHDRPLTASSSLAPGQRVQNLHAYQSGRLSYDQQQQQQQQQQQQQQALQSRHHAQETLHYQNLAKYQHYGQQGQGYCQPDAAVRTPEQYYQTFSPSSSHSPARSVGRSPSYSSTPSPLMPNLENFPYSQQPLSTGAFPAGITDHSHFMPLLNPSPTDATSSVDTQAGNCKPLQKDKLPENLLSDLSLQSLTALTSQVENISNTVQQLLLSKAAVPQKKGVKNLVSRTPEQHKSQHCSPEGSGYSAEPAGTPLSEPPSSTPQSTHAEPQEADYLSGSEDPLERSFLYCNQARGSPARVNSNSKAKPESVSTCSVTSPDDMSTKSDDSFQSLHGSLPLDSFSKFVAGERDCPRLLLSALAQEDLASEILGLQEAIGEKADKAWAEAPSLVKDSSKPPFSLENHSACLDSVAKSAWPRPGEPEALPDSLQLDKGGNAKDFSPGLFEDPSVAFATPDPKKTTGPLSFGTKPTLGVPAPDPTTAAFDCFPDTTAASSADSANPFAWPEENLGDACPRWGLHPGELTKGLEQGGKASDGISKGDTHEASACLGFQEEDPPGEKVASLPGDFKQEEVGGVKEEAGGLLQCPEVAKADRWLEDSRHCCSTADFGDLPLLPPTSRKEDLEAEEEYSSLCELLGSPEQRPGMQDPLSPKAPLICTKEEVEEVLDSKAGWGSPCHLSGESVILLGPTVGTESKVQSWFESSLSHMKPGEEGPDGERAPGDSTTSDASLAQKPNKPAVPEAPIAKKEPVPRGKSLRSRRVHRGLPEAEDSPCRAPVLPKDLLLPESCTGPPQGQMEGAGAPGRGASEGLPRMCTRSLTALSEPRTPGPPGLTTTPAPPDKLGGKQRAAFKSGKRVGKPSPKAASSPSNPAALPVASDSSPMGSKTKETDSPSTPGKDQRSMILRSRTKTQEIFHSKRRRPSEGRLPNCRATKKLLDNSHLPATFKVSSSPQKEGRVSQRARVPKPGAGSKLSDRPLHALKRKSAFMAPVPTKKRNLVLRSRSSSSSNASGNGGDGKEERPEGSPTLFKRMSSPKKAKPTKGNGEPATKLPPPETPDACLKLASRAAFQGAMKTKVLPPRKGRGLKLEAIVQKITSPSLKKFACKAPGASPGNPLSPSLSDKDRGLKGAGGSPVGVEEGLVNVGTGQKLPTSGADPLCRNPTNRSLKGKLMNSKKLSSTDCFKTEAFTSPEALQPGGTALAPKKRSRKGRAGAHGLSKGPLEKRPYLGPALLLTPRDRASGTQGASEDNSGGGGKKPKMEELGLASQPPEGRPCQPQTRAQKQPGHTNYSSYSKRKRLTRGRAKNTTSSPCKGRAKRRRQQQVLPLDPAEPEIRLKYISSCKRLRSDSRTPAFSPFVRVEKRDAFTTICTVVNSPGDAPKPHRKPSSSASSSSSSSSFSLDAAGASLATLPGGSILQPRPSLPLSSTMHLGPVVSKALSTSCLVCCLCQNPANFKDLGDLCGPYYPEHCLPKKKPKLKEKVRPEGTCEEASLPLERTLKGPECAAAATAGKPPRPDGPADPAKQGPLRTSARGLSRRLQSCYCCDGREDGGEEAAPADKGRKHECSKEAPAEPGGEAQEHWVHEACAVWTGGVYLVAGKLFGLQEAMKVAVDM,NQPESCSLFEKGVVSMANNRTTSRPRRKHHARITGSRVRPGAATGSGCSPRTIITRSLTRAMRVALARPLALQPRWPPTSTTEAARPCPHSKACRGGRLSLATASRTAAPTQAAMLVRRAFRLGGPHSHHPHSRSHYLQGWPSMMRTKRQQCPPAGSMQSRAPRCPFGLTPCTSSSHRRPSSPWHTPSSKGRSCRTTLPPLCPSPRVPTFLSIPSPSPPPPPTPPLSRVVGRGPTPIRVAQHRLPSPMTGRLPAPAWPRGSGSRIFMPTSRAASAMTSSSSSSSSSSSSSKPFRAGTMPRKPSITKTSPSISTTGSKARATASRTQPSGPQSSTTRPSAPAPATHPPAPWAAHLPTVPHRRRCQTWRTFPTASSRSAPGPSPQGSLTTATSCPCSIPPQRMPPALWTPRLATASPFRRTSSLRTCCRISACRASRRPHRWRTSPTPSSSCCSPRLLCRRRKVSRTSCPGPQSSIKASTAAPKGAATQPSPQAHRCQSRRAARHSPRMRSRRRPTTAAPRTHWSAASSTATRPVAALPGSTATRRPSPSPCPPVLPLLTTCPPNLTTPSRAYTAVCRSTASPSSWRVSGTVRGCCSAPWHRRTWPPRSWGCRKPSVRRPTKLGLKHPAWSRTAASHPSRWRTTAPAWTLWPRVRGPGLGSRRPCPTPCSWTRAAMPRTSAQGCLKTLPWPSLRLTPKRQLVLSPLVPSPPLGFLLQTPLQQLLTVSRTQPLPAQRTAPTPLPGQRKTWGMLVPGGDCTLASLPRAWSRVGRPQMASAKGTPMRLRPAWASRRRTPLGRRWPRCPGTSSRRRWVGRRRQVGCCSAPRWPRLTGGWRTAGTAVPPPTSGTSHCCHPPAGRRTWKLRRSTPPYVSSWAAPSRGLACRTRCHPRPHSSAPRRRWRRCWTPRPAGALRATSQGSPSSCWALQWAPSQRSRAGLSPLCHTSQVKRGLMGSELQGIPPPRTPLWPRSPTSLLCPRRPSQRKSLCHGAKAYGAVGCTGGCPRPRTPHAGHQCCPKTSCSLNPAQGPPRDRWKGLEPQAGGPRKGSPGCVLVLSRPVSPARPDPQAPPPLHPQTNWGASSEPPSSRASGWGSPHPRLPPAPATRPPCLWPPTAARWAPRPRRQTHPARLARTSAPSFGHAPKPRRSSTPSGGGPLRAGSPTAVPPRSSSTTATCPPHSRSPAAPRRRAGASGQGSPNLVQAASSLTGPSMRSKGSRPSWRRSPPRSGTWSCGAAAAAAATPVAMGEMGRRRGLRVPPPSSRGCLLPRKPSPPRAMASLPQSSHPRRPPMPASSSPLGQPSRGPRPRCCHPGRAGASWKPSCRRSPRPASRSSHVKRQGPLLVILAHPFPTKTVGSRVLGAAQWGWKKAWMWAPGRSSQLLGLIRYAEIQPTDPKANSTVRNCLLLTVSKPRPSHPRRPCSLGGLPWRLRRGAGKAGQGPMDSPKARWRSGPILARLCSLPETGPVAHKGPVRTTLVEEARSQRWRSWAWPPSPRRAGPASPRQGHRNSQATPTTAAIPSGSASLGAGPRTPPLHPVRGVPSDDDSSRCCPWIPQSLKSASSTFPLASGGQTAGPPPSHPSCGWRSETRSPPYALLSTPLEMRPSPTGSLPPLPPLPHPRPRSPWMQPGPPWPHSLEAPSCSRGPPCPSPPRCTWGLWFPRPVPLALFAASAKTRPTSRTLGTSVGPTTLNTASPKRSQNSRRRCGQKAPVRRPRCRLREHSKVPSVQLPPLPGSPPGLTAQLTRPSRAHCAPVPGACPGGCRAATAVMAGRMGARRQPQPTRVANMSAARRLRQSPAGRPRSTGCMRPVPCGPAASTWWPGSSLGCRRPRWPWT