McDonnell Genome Institute

Washington University

CircRNA

chr17|1769851|1772075|+|SERPINF1|ENST00000254722.8

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9648

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

10

Peptide

RSAFSFSVWR

Amino Acids from 5' Exons

GSPDPDSTGALVEEEDPFFKVPVNKLAAAVSNFGYDLYRVRSSTSPTTNVLLSPLSVATALSALSL,APQTPTAQGRWWRRRILSSKSPTSWQRLSPTSAMTCTGCDPARAPRPTCSCLLSVWPRPSRPSRW,LPRPRQHRGAGGGGGSFLQSPREQAGSGCLQLRLPVPGAIQHEPHDQRAPVSSQCGHGPLGPLA

Amino Acids from 3' Exons

SCANPALWHLWKSHMGPGPESRATLAWTCKRSTTGCRRRKGSSPGPQRKFPMRSAFSFSVWRTSR,AAHKIQLCGTSGKVIWDQAQSPDGQPSLGPARDQQLGAGADEREARQVHKGNSRDQHSPSRCGALQ,LRIKSSFVAPLEKSYGTRPRVLTGNPRLDLQEINNWVQAQMKGKLARSTKEIPDEISILLLGVAHFK