McDonnell Genome Institute

Washington University

CircRNA

chr17|17270757|17276164|-|COPS3|ENST00000462236.1

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9832

8

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

11

Peptide

TGQMTQLCELINK

Amino Acids from 5' Exons

VCEVFYAQCSLRNAILTGSALHQHLWGAHSICNRHLAKHFILHKYFALVVIFIFIFCYCILLGFAISQMHLWKEN,FVKFSMPSVPDFETLFSQVQLFISTCNGEHIRYATDTCKLNNILFSIENILPLWLYLYFEYFVIVSSCWALPSANKCTCGKKT,LSFLCPVFLTSKRYSHRFSSSSALVMGSTFDMQQTLVSITFYSPLKIFCPCGYIYILNILLLYLVAGLCHQLTNALVERKQ

Amino Acids from 3' Exons

GKHSFVNSTRVGNSLRRTYPIWTLCSGLWMYKNTPWASLLF,ANDTALTDQQEWGTPCEELIPSGHCARGSGCTRTLLGRPCCF,QMTQLCELINKSGELLAKNLSHLDTVLGALDVQEHSLGVLAV