McDonnell Genome Institute

Washington University

CircRNA

chr17|1673745|1675339|-|PRPF8|ENST00000304992.10

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9995

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

22

Peptide

MLTCINNLQDVWETSEGECNVMLESR

Amino Acids from 5' Exons

VHSRGSGPDSTLPDRAPPQKHRWLQEVLAPRCPHAPHETCL,FTADEARDLIQRYLTEHPDPNNENIVGYNNKKCWPRDARMRLMKHDVN,SQQMRLGTFNVTQSTLTPIMKTSLAIITRSAGPEMPACASNMMLT

Amino Acids from 3' Exons

ASITCRTCGRRVKASAMSCWNPALRRCMRRSTLCSTGCCASSWTTTPTTQPRTTSSSTI,HQPAGRVGDERRVQCHAGIPLEDVEDRLDSAQQAAAPHRGPQHSRLHDSQEQRRHQL,INNLQDVWETSEGECNVMLESRFEKMYEKIDLTLLNRLLRLIVDHNIADYMTAKNNVVINYK