McDonnell Genome Institute

Washington University

CircRNA

chr17|16098366|16165161|-|NCOR1|ENST00000268712.7

Cancer

Type of Peptide

BRCA-Basal-like

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9057

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

7

Peptide

AAVIPPMDPAFGGK

Amino Acids from 5' Exons

NVSYGLKAFTVKPHWIYTRLISVKTKSTGSATASASSCCYPTN,MFPMDSKPSLLNPTGSILVSSPLKPNPLDLPQLQHRAAVIPPM,CFLWTQSLHCTPLDLYSSHLRNQIHWICHSFSIELLLSHQ

Amino Acids from 3' Exons

DPAFGGKHEAPSSPISGQPCGDDQNASPSKLSKEELIQSMDRVDREIAKVEQQILKLKKKQ,IQHSEANMKLHPLQFRGNHVEMIKMLHLQNSQRKSYRVWIVIEKLQKNSRSLNKRN,SSIRRQTSSILSNFGATMWRSKCFTFKTLKGRVNTEYGSCRSRNCKSRTADPTEKET