McDonnell Genome Institute

Washington University

CircRNA

chr17|16087171|16087345|-|NCOR1|ENST00000436068.1

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9997

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

11

Peptide

SVAYMPYAEVK

Amino Acids from 5' Exons

ENQSPICLMLRSNVLNRKHRCTILQQGQPHRVGFLQEKSVKPLHSLIVQPAIVSRQ,KISRLYALCGQTCSRTGSTDAQYCSKVSLTVAFSKRSQSRSTAYECSPLCPA,KSVAYMPYAEVKRALEQEAQMHNTAARSASPCRLSPREVSKAAPQPDMSAARYSVPP

Amino Acids from 3' Exons

ENQSPICLMLRSNVLNRKHRCTILQQGQPHRVGFLQEKSVKPLHSLIVQPAIVSRQ,KISRLYALCGQTCSRTGSTDAQYCSKVSLTVAFSKRSQSRSTAYECSPLCPA,KSVAYMPYAEVKRALEQEAQMHNTAARSASPCRLSPREVSKAAPQPDMSAARYSVPP