McDonnell Genome Institute

Washington University

CircRNA

chr17|16046950|16065694|-|NCOR1|ENST00000268712.7

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9619

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

12

8

Peptide

LNSSGGGDSDMAAAAYLFQR

Amino Acids from 5' Exons

ECPLTREYKLLAFILHQAKYITHGIKEAGDFSVELLWWRLY,NDARSPGSISYLPSFFTKLENTSPMVKSKKQEIFRKLNSSGGGDSDM,MMPAHQGVATCLHSSPSLKIHHPWLNQRSRRFFVSTPLVEVTLIW

Amino Acids from 3' Exons

QRLLTCFRDSFHQLQVTQVSISFTQWRTQDRQSMITLPHNRCKTCVQMWPEDSPQESSHWVSHTQQRE,SGCLPVSETAFTNSRLPKSVSALRNGEHKTDNLKLHYLTTDASELASRCGQRTLPKRAATGSPIPSNE,AAAYLFQRQLSPTPGYPSQYQLYAMENTRQTILNDYITSQQMQVNLRPDVARGLSPREQPLGLPYPATR