McDonnell Genome Institute

Washington University

CircRNA

chr17|1050049|1050634|-|ABR|ENST00000291107.6

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9475

33

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

7

Peptide

GQIQTCTVPWR

Amino Acids from 5' Exons

EFEIELEGSQSLRILCYEKCYDKTKVNKDNNEIVDKIMGKGQIQ,SLRSSWRAPSPGSCAMRSAMTRPRSTRTTMRSWTRSWAKDRS,VDRAGGLPVPEDPVLEVLQDQGQQGQQDRGQDHGQRTDP

Amino Acids from 3' Exons

TCTVPWRWIPSAILSAKPKPGCSGTQRSPSGM,PVLYPGGGFLRLFCQQSQNQGVPGHSGAQVG,LYCTLEVDSFGYFVSKAKTRVFRDTAEPKWDE