McDonnell Genome Institute

Washington University

CircRNA

chr16|90036380|90040509|+|GAS8|ENST00000569558.5

Cancer

Type of Peptide

OSCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.965

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

12

3

Peptide

LFDNAPLISLTEIPK

Amino Acids from 5' Exons

KLRPSMIRRRCGTNSTCGERLSSTKWRRGRMARSTRCSATRRPSPTLRTTTTTSPSTTWPSSTPSRCCAWAGLGRHTLPVLECGLQSPGDPDPSSPPQHTQYFLDCLTMPLSYPLKFLNNVTYLYLLLKAVRILPSPCRGGSNEVCSGLKLRWNRSEGRDVAGVDRCHSHCLRQVDRCHRHCMLAVTGFSTVDNGPWWNLEQSIVLQSAWKLHSQKTQNKLKLQKYCLYIEDVVPACLRLAAAGDGQESTQLSPCRPQPLWFCLLSPCRACACACRSRWRTCGRRRTTWRGRWQRCLGRTSAWQTLSRRLGRRARCRNSSQTTRGTSRSC,NGQVEDEDAEGRTRLAEKDAPRSGGEEEWPDPHADAAPRGGLHRHELLQRHHPQQPGPHQLPQGAVRGLGWGGTLCLSNVGCRVLGIQTPALHPNTPSTFYKIVQCPSHILNNSITPISTYCKQSGYCPHRSAEGEVMKCVLVCKSSDGTAVRAVMWLEWIGVIVTACDRWIGVIVTACWQQDFLQTTALGGILNKVSFSLHGSCIPRKLRISSCRNTVYTKTSRCQHAGWQQLVMGRRAPSSHHAGHSPFGSACAPAGPVLVPAGADGGHAEEGGPPGEGDGRGVWAEQAPGRPSPEGSGGDERDAETARKLREGQADPA,IEAKYDKKMKMLRDELDLRRKTELHEVEERKNGQIHTLMQRHEEAFTDIKNYYNDITLNNLALINSLKVLCVGWAGEAHSACPRMWAAESWGSRPQLSTPTHPVLFIRLFDNAPLISLTEIPKRNLSLPIVKSSQDIALTVVQRGKSVFWFVKAQMEPQGPCGWSGVSSLPATGGVSSSLHAGSDRIFYSRQRPLVESTKYSPSVCMEAAFPENSEVEAAEILFIHRRRLGASMPEAGSSWWAGEHPALTMQATAPLVLPAEPLPGLCLCLQEQMEDMRKKEDHLEREMAEVSGQNKRLADPLQKAREEMSEMQKQLANYERDKQILL

Amino Acids from 3' Exons

VQQERDELYRKFTAAIQEVQQKTGFKNLVLERKLQALSAAVEKKEVQFNEVLAASNLDPAALTLVSRKLE,CSRSGTSSIGSSPQPSRRCSRRQGSRTSCNASCRLAPLWRRRRCSSTRSWLPLTWTLQPRWCPASW,AAGAGRALSEVHRSHPGGAAEDRVQEPRARTQAAGSERRCGEEGGAVQRGPGCLPGPCSPDAGVPQAG