McDonnell Genome Institute

Washington University

CircRNA

chr16|89544647|89548113|+|SPG7|ENST00000268704.6

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9604

13

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

16

3

Peptide

VLAGMGTTDHVIVLASTNR

Amino Acids from 5' Exons

EWVPQTMSSSWRPRTELTFWTVLGQADWTGTSSLISPRC,NGYHRPCHRPGVHEPSHFGRCSDEARPTGPARLHSPHAA,MGTTDHVIVLASTNRADILDGALMRPGRLDRHVFIDLPTLQ

Amino Acids from 3' Exons

GLTSPTSAMRLRCTRRGRDTLPCTLSTSSTPWSASSQ,GHRQHLQGCAARGAGGTHFRAHSQLRVRRGARPR,ADIANICNEAALHAAREGHTSVHTLNFEYAVERVLA