McDonnell Genome Institute

Washington University

CircRNA

chr16|89279071|89286186|-|ANKRD11|ENST00000301030.8

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9995

9

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

2

Peptide

ASSQVYK

Amino Acids from 5' Exons

RAQKRKTHHPSHLPVQSTATTRTPSSKKASSTRPRTQSHRRPRPPSRTSMSLMRTTSRTGFLRWTTSTYKRTTEKKRNPIVLSLYPKWRLKVTLKITRLHQRKRPIVSCQTRRTRRTRVSPWGQERSDSRHIRYCLVVRHESLLMPSSRRKKIKKRSERKKQKAERFASESGATSSAPRSRRASPQRVGRMTGTLWGALAASRGPRWCRTPPCSAPSLPPPPRLTGALPPRSRTPATQTSTPSTGGQTIGKPFLPRLGQRSVLYQTPQGRDQASLTTPLRAPVWNRSQGRGRSTGSEPPCRRRRAPSCPARRALSPNWTRRGKLSKNIKQNTNTKTRRRDSVPSAKSSKVLLTNMRTPSRSQIRLYCRMIFPLKTSKCSTIATTLKKKRNLAKNKKKNGSLKMKNHRESKTQTKTSAGLSEKRKTVRIKQKRRDRRKSLRKKKNDCTKRRERRNQKTGPQNRRRMIKRTKFQKRRRRFLKKIKKNSKKKRFIGKILLLTNIVTKISFWRMKTPNLAFLTISEIGGFLTCPIHPLISKGRTAGTRQQTTGTRATLWPSSSWRRRRTARRGGGTAGPGRSETTESPSSERRTGTIWIKTLRRGKSRPKSIKVSLATFRKRTRRGESPQRPGGTERTPWRAARSAGTAGPSPRRRTGRSRSVAARVASRTSPTATLGRAWSRGNGTTQHERRRRRMAPIRKGRRRQNQKDTKRNPVTRTKVRNQSWKNVRRTKNLINVLKRKKIPRKNIKTHMAKTKKGKRLSTKGKRRRRRLSLGSSQKTSLKKKMTRKAKRKAGTSQTSSQMRVRTTETAAWGAGSRWERPATCRGRTASRRRRKDGRPMPPTDTGSLLTSSTLRGRRTRSPETGERTEGLPTRGETKKRKSLKSTRRRRIKSPQKSTRTGRTEPQWTPRKIRKINRSSPRRLKRSTLPKTRLKANTKRSRTKNIPRRGSPREVPTRKKACLKSWKKRLSMSTEKTPTIKSARSPLTASRTEGRSRGLPSWRSLSRSHLETTSRGRAPASLRSKRRRGTDTPHLHPRRATTESEPRKRRPRRKRRAKITRRAVAGRTPASTKRTSWRRMLTEFLTTKLTKMSIKPLNCFLPKRKIKMIPRENLPRKKRNSLMDLVPSTSKRRRRERNTGRNGETRRRGTGTGMRMGCCGITGTSSCGITGTSRSPPPGTRTARPACSKTSPGTRARGSAMPNRRNSRTVQRKKRATQRATGMIRRHPKTQARKTPGPGRSSWGTATPASRGCCPRRTWRSRSATSGTRRGSKWRSGTGPETPSSRRRRSRQTTGGRRVWTFLLRNRRGWTLHLKTKSSKSRLLFHLPRKISYTQHQVQTPKTGWQALTKRSCLRPPGLTRAGPLACPPLRRCYPAPATRRCTRPGPRPAAPMTTRTSCSTAPTRSTPRPCPPLPPAPAPPPFSTGSPWLQVGFRKTPARLLPGLSPQTFTARSLSTLGGPPRKNSASETSSSGSRAFLLPPATTLPCHPRWKTGRPCPRFPRRSLPACRQGTTPQTMASRRPKSTLCTAHRLPLSLSPRLQRASSQVYKQNLPLPPEPSCWFLPSKGPFPRTWTPPRTSRRRPPSSPRSPATWSRWTRVPSAPSSPRSPLSGPTPPSRRLPLASGAPLKTLAGLWARTSCSLHRDSPSPQSVSAPRTPSTLPPQGPSAPRRRRTPPLPPLLPRTLCPSLSRGWRTSRTEWTPSPPPSPPQRRLPTPLPPGWSPSSATASHFRKPRWTWPPSPPVPLWLRWRLWGPWKIASWTAAAACLTSARWSRCPGRTPSPAPRTTWTWGPSPCRSFPCRLKMPQMVKRNPWKKVLLLQKRCLQGPPGSTVGMFPPWLRSRRHCLLTRPPPGSLQSSSLSPQGSQSWTWLKLRWRRRRCRKRGPVGIRTPAWSPRPFPQNSAHWGAETRGLRLKAPPPRPSVPLTAPPRTLWHKLRPQTVPAPRTTLRPPVPPPQPKALLAASSRKPQNQNPRPKPRRPPEWRRSLSAPGTGRRCSRTRASRARPPPRRSAPPPLPRSPGPRPAAPRTTTPRPSIRANAAFSAPPSSCSSSTRPRSRRGRSSRRWPPSWTPSSWMPSSPTTATGPTPTSNTCRSGRRSRRSARSCAVSRRRRPSATPSTSPTRAPTSWTASRSASSTSP,ELRRGRRTILRTFQFSRRQQHGLRVRKRPQAQGQEPRATEGHGPRQGRVVGRRAGQGSSGGRQAPIEKGLQKRNEIQFYLYTQNGGKLHKHDCTKESVPSYPVRHVGRGGRECHRGDRREAETLGTYDIAWDTRAFCQAAEGKKSEKEAKERNKRQRGSLRKAERQVLLLGVGERVLREWGGQGLSGELWLPQGVPAGAEGPLPVQLPLCLLHLVSRELCRPEAEPQPHRPAHQALADRQLENHFFPGLVRGQFFIRLHKDETDKRVLLLGLQCGIAEASEEEAGAQEASLPVGEEEPLPVQRGGRCPQTGQGGESCQKTNKTQTQKQGEGTVFHQPRAEVEKFYLRIGLQAEVRGYTVRESFHKQAKSVKARSRPLKRRETQNEIRRKRMALRKITEENQRHKQRHQQVFPRRERPFESRKGEIAEGKVSERRKTETVQRGEKEEIKRPALKIREEEFKRGQNFKREGEDFRRRKTQKRKGLGRFCFRILQKSVSGERHQIPFRSARSVVFLVRFILFQRGGQLGLASDRLQGHEERLCGQAHLGDGEGGQQGEEAGQPGPGEARLQRALLPKEGQGLFGKLEEERADRKAKCPWLPFGKGQEEERVRRGRAGQKGRPGELQGAQGRQGQARGGAPGGAEGVWLREWLQGQVRRRLWEGPGAVGTAPPSTREGEEGWPRGKEGEDKTRKIQREIQQGQKEINPGKMSEGQRIMFREKRYQGKTRHTWQRQRKESVSRPREREEGEGFPWDHLRRLLKKRQERQREKLVHRRHLHREGRQRQLHGERVQDGRGQRLAEDGRPPGEGGRTGGLCLRQTQEVFQAAPEAEGQGAQRQEKGPRGCRRGERQKRESLKAQGEEGRVHRKVQGQEGQSLSGLHAREKTEAPREGKEARCRRQGKQTQREVGQRTFQGEEVLEKCRRGKKPAKVGRRGSPVQRRLQRNQRGLLQLHGPRAGAGADCLPGGLFHGATWRRQAEGERLPPEAEREGEAQTLLIFIQEEPRPRASQEREGREEREGRRLQGGRQEGLRPVRKGLPGGGCLRSFLQHESHRRARNHIVFYRKERKFRERTFQENRKGTKALWICHQHPKREEEERETQGEMERREGEAPGQACGWAAAASQGRAPAASQGRAEARHQGQGQPAPRAQRQVQGRGPEARRCQTEGEIQGRCRERKGRPSEDEQREGSAIQRPRQERRQAQGEAPGGRRPDDDQLREDAVPEGPGDRGAPQAAQGEDEANGEAEAPVRRPQAQGEGEAGRRRAEEGSGHSCETAGAGPSIRQKAQRVDSYSTCRGKATPSIRCRLQRLAGRPSHERGPACVPQAPEPAHWRAHPYVGAILPQLRGGDAHAQDPVLQRRLRGPRVRLRRLAALHARAHRSHQRLLPLLFRQVLRGFKWAFGKRQPGSCQASLHKPLPLGLCRHEDPRGRIQRRRQALQAAERSCCLQLRLSHATLDGRQGAPAPGSRGEVCLLVARVLLPRLWPPVAQSRRFALPTGCRCHCHPVSRGRLLKFTSKTFPFPQSRAAGSFPRRGPSPGPGHLRGPAGDGRHHPPGAQLPGAAGRGSLQRRHHRGARVGPPLRAGACLPDRGHLKPCELACGLGPPAEVSTEIPRVPKAFLPRGPPPLCRPRALQRLGGAVPRPSRLSCPVRSARRAGAGGRQGRSGRRPRRHLHLRGGSLRPSLRAGVLLQQLQVTSGSPAGRGPRARLCSRCGSGGGSGAPGKLPGRQPRPVSPRPGGAGALGGRLRRPRGRPGPGALLPAGASPADRCRRWSGTRGRKSCSSRRDASRGPRGHKRWGCFHRSGGAAGTASPGLHPAPCRARAALRGAKAGRGSRSCGGGGDGAGREGPWGSGLQRGARARSPRTAPTGERRPGGGRPPRRVPLCPRPRPEHCGTSSGRRRCRPRGRHGLPCRRPSRRPSWRHPAGSRRTKTHGRSPEGPPSGGDPSAHDQEPGADAREPEQAGPAPLREGVRPHPCPGHQGQGPRLRGRRRPGPASAQTPLSALHPAAAAAAEHVHAADAGGDPADAGRHRGRHQAGCHRALPQRQGQPLLRIPADQEEDRGEAQDPVLYHAAGAPVLRRVRHLHGLLPPGRQAAQQAPHPR,SSEEEDAPSFAPSSSVDGNNTDSEFEKGLKHKAKNPEPQKATAPVKDEYEFDEDDEQDRVPPVDDKHLLKKDYRKETKSNSFISIPKMEVKSYTKNNTIAPKKASHRILSDTSDEEDASVTVGTGEKLRLSAHTILPGSKTREPSNAKQQKEKNKVKKKRKKETKGREVRFGKRSDKFCSSESESESSESGEDDRDSLGSSGCLKGSPLVLKDPSLFSSLSASSTSSHGSSAAQKQNPSHTDQHTKHWRTDNWKTISSPAWSEVSSLSDSTRTRLTSESDYSSEGSSVESLKPVRKRQEHRKRASLSEKKSPFLSSAEGAVPKLDKEGKVVKKHKTKHKHKNKEKGQCSISQELKLKSFTYEYEDSKQKSDKAILLENDLSTENKLKVLKHDRDHFKKEEKLSKMKLEEKEWLFKDEKSLKRIKDTNKDISRSFREEKDRSNKAEKERSLKEKSPKEEKLRLYKEERKKKSKDRPSKLEKKNDLKEDKISKEKEKIFKEDKEKLKKEKVYREDSAFDEYCNKNQFLENEDTKFSLSDDQRDRWFSDLSDSSFDFKGEDSWDSPVTDYRDMKSDSVAKLILETVKEDSKERRRDSRAREKRDYREPFFRKKDRDYLDKNSEKRKEQTEKHKSVPGYLSEKDKKRRESAEAGRDRKDALESCKERRDGRAKPEEAHREELKECGCESGFKDKSDGDFGKGLEPWERHHPAREKEKKDGPDKERKEKTKPERYKEKSSDKDKSEKSILEKCQKDKEFDKCFKEKKDTKEKHKDTHGKDKERKASLDQGKEKKEKAFPGIISEDFSEKKDDKKGKEKSWYIADIFTDESEDDRDSCMGSGFKMGEASDLPRTDGLQEKEEGREAYASDRHRKSSDKQHPERQKDKEPRDRRKDRGAADAGRDKKEKVFEKHKEKKDKESTEKYKDRKDRASVDSTQDKKNKQKLPEKAEKKHAAEDKAKSKHKEKSDKEHSKERKSSRSADAEKSLLEKLEEEALHEYREDSNDKISEVSSDSFTDRGQEPGLTAFLEVSFTEPPGDDKPRESACLPEKLKEKERHRHSSSSSKKSHDRERAKKEKAEKKEKGEDYKEGGSRKDSGQYEKDFLEADAYGVSYNMKADIEDELDKTIELFSTEKKDKNDSEREPSKKIEKELKPYGSSAINILKEKKKREKHREKWRDEKERHRDRHADGLLRHHRDELLRHHRDEQKPATRDKDSPPRVLKDKSRDEGPRLGDAKLKEKFKDGAEKEKGDPVKMSNGNDKVAPSKDPGKKDARPREKLLGDGDLMMTSFERMLSQKDLEIEERHKRHKERMKQMEKLRHRSGDPKLKEKAKPADDGRKKGLDIPAKKPPGLDPPFKDKKLKESTPIPPAAENKLHPASGADSKDWLAGPHMKEVLPASPRPDQSRPTGVPTPTSVLSCPSYEEVMHTPRTPSCSADDYADLVFDCADSQHSTPVPTAPTSACSPSFFDRFSVASSGLSENASQAPARPLSTNLYRSVSVDIRRTPEEEFSVGDKLFRQQSVPAASSYDSPMPPSMEDRAPLPPVPAEKFACLSPGYYSPDYGLPSPKVDALHCPPAAVVTVTPSPEGVFSSLQAKPSPSPRAELLVPSLEGALPPDLDTSEDQQATAAIIPPEPSYLEPLDEGPFSAVITEEPVEWAHPSEQALASSLIGGTSENPVSWPVGSDLLLKSPQRFPESPKRFCPADPLHSAAPGPFSASEAPYPAPPASPAPYALPVAEPGLEDVKDGVDAVPAAISTSEAAPYAPPSGLESFFSNCKSLPEAPLDVAPEPACVAAVAQVEALGPLENSFLDGSRGLSHLGQVEPVPWADAFAGPEDDLDLGPFSLPELPLQTKDAADGEAEPVEESLAPPEEMPPGAPGVINGGDVSTVVAEEPPALPPDQASTRLPAELEPEPSGEPKLDVALEAAVEAETVPEERARGDPDSSVEPAPVPPEQRPLGSGDQGAEAEGPPAASLCAPDGPAPNTVAQAQAADGAGPEDDTEASRAAAPAEGPPGGIQPEAAEPKPTAEAPKAPRVEEIPQRMTRNRAQMLANQSKQGPPPSEKECAPTPAPVTRAKARGSEDDDAQAQHPRKRRFQRSTQQLQQQLNTSTQQTREVIQQTLAAIVDAIKLDAIEPYHSDRANPYFEYLQIRKKIEEKRKILCCITPQAPQCYAEYVTYTGSYLLDGKPLSKLHIPV

Amino Acids from 3' Exons

VVKLLLRYGGNPQQSNRKGETPLKVANSPTMVNLLLGKGTYTSSEESST,WSCCCGTEGTRSRATGKARRRKWPTPPRWTSCAKALTLPARRARR,GEAAAAVRREPAAEQQERRDAAESGQLPHDGEPPVRQRHLHFQRGELD