McDonnell Genome Institute

Washington University

CircRNA

chr16|89191329|89193913|+|CDH15|ENST00000289746.2

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9842

21

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

4

Peptide

AQPGVPLPQGR

Amino Acids from 5' Exons

LLQGLRPGRLAASGRSHWPDPDPARAQPGVPLPQGRLVQSHRPGPG,YSKDYDPEDWLQVDAATGRIQTQHVLSPASPFLKGGWYRAIVLAQDD,TPRTTTRKTGCKWTQPLAGSRPSTCSARRPPSSRAAGTEPSSWPRMT

Amino Acids from 3' Exons

DAYDISQLRHPTALSLPLGPPPLRRDAPQGRLHPQPPRVLPTSPLDIADFIND,TPTTSASCVTRQRACLWDRRHFAEMPRRAACTPSHPECCPPAPWTSPTSSM,RLRHQPAASPDSAEPASGTAATSQRCPAGPPAPPATPSAAHQPPGHRRLHQ