McDonnell Genome Institute

Washington University

CircRNA

chr16|89098590|89101347|+|ACSF3|ENST00000317447.8

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9509

14

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

14

Peptide

SAGSAGVSAGTSGR

Amino Acids from 5' Exons

VSHRPSGFQRQAWCLPQEDEHLHCLHLIVPFHLLKQLCLPLLTANFPLPPLSGSGA,CPTGLPGSSARPGACPRRMSICIACTLSCPSTCSSCACRSCELRTSPYLLSLAREL,VPPAFRVPAPGLVPAPGGAFALPAPYRALPPAEAAVPAALVNCELPLTSSLWLGSW

Amino Acids from 3' Exons

LGRLSVQCCPMWCSPSGAWAAPWRPAGWRLRDTEEVVFCTQPQWPARTGAPRCSPVPWPLGTESPWLTSTAATRTGSFIPAAFACPRRSAGSAGVSAGTSGRRGSPSYALTMPPTSWPSGRHGVAVWQSPSTGSIPRPSWSMSSATPRALWSLPARSTWSSARWSGSWGSRCCRSHQPSTLEQRNRQRSRSQSRDGGTRAPSSTPVGPRGGPRACARTKTSGL,SAACQCNAAPCGAHLPAPGLRLGVLPAGACETQRKWSSAHSPSGPLGQERPGVHPCPGLWGQNRPGPARPPHVQGALFPQPSPVPGDLQALRVCRRGPPGGEGLLPMRRCLLRRGPVGVMDEWRCGSPPLQEASRGPAGVCHLRLPELCGPCQPGVPGAPEPGGQEAGGPAAAAHTSHLHWSSRGTGRGPGPRAGMEEQGRHDHLHQWDHGEAQGRAEHAPKHQGC,RPPVSAMLPHVVLTFRRLGCALASCRLAPARHRGSGLLHTAPVARSDRSAPVFTRALAFGDRIALVDQHGRHTYRELYSRSLRLSQEICRLCGCVGGDLREERVSFLCANDASYVVAQWASWMSGGVAVPLYRKHPAAQLEYVICDSQSSVVLASQEYLELLSPVVRKLGVPLLPLTPAIYTGAVEEPAEVPVPEQGWRNKGAMIIYTSGTTGRPKGVLSTHQNIRAV