McDonnell Genome Institute

Washington University

CircRNA

chr16|8768192|8775057|+|ABAT|ENST00000268251.12

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9982

56

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

19

16

Peptide

MMTGGFFHKEEFRPNAAPGCPDYSILSFMGAFHGR

Amino Acids from 5' Exons

APGCPDYSILSFMGAFHGRTM,PLAAPTTASSPSWARSMGGPW,PWLPRLQHPLLHGRVPWEDH

Amino Acids from 3' Exons

HGCAFLVDEVQTGGGCTGKFWAHEHWGLDDPADVMTFSKKMMTGGFFHKEEFRPNA,MAAPSWWTRSRPEEAARASSGPMSTGAWMTQQTPSARRLGASSTRRSSGLM,WLRLLGGRGPDRRRLHGQVLGPALGPGPSRRDDLQQEDDDWGLLPQGGVQAC