McDonnell Genome Institute

Washington University

CircRNA

chr16|87644257|87645035|+|JPH3|ENST00000284262.2

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9654

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

8

Peptide

DLPGPVGR

Amino Acids from 5' Exons

GPTRASGSVACARATASGRASRMAWPRSSAHPGRPSTPCAASTPTARRCIPTPLRRWPAARPCPAGASCSWPTVTPRSSRARRRGCFGARCVGSCASRSPRAAWPANAASRAPFAARRAAPSAPRPATSTPPSAWARLRPSWRSSRTTSTPPPPRPTWASGRTTNAPASAASARTGSSTRASGPATGAMATAAPSRTAPRRRASTSRTSSSAASARTSSPCGPARSARRWTAPLRPLSGPPPSPSRRLRSRLP,DLPGPVGRWHAPGLRRPAERPVWHGRGHPLTPEDVHQLPAQRAHQRHGAASRRLSGGGRQPGRVPRGLRARGPQLRDPQEQEEGAVSALAAEWAEAAQVGVQEQPGQPTQQAELLSQRGGHEHRQLHGQRHPLHHQPGRGGRAGGHRGRHRRHHHRDLRGRVEERQTLRLRREPALGRAQVRGRVGQQPAPWLRLHDLPGRHQGGGQVQAEHPRRRQAQEPHPPAGQQDPREGGPRRGRAGRHHRQAEGDRGFQ,TYQGQWVGGMRQGYGVRQSVPYGMAAVIRSPLRTSINSLRSEHTNGTALHPDASPAVAGSPAVSRGGFVLVAHSDSEILKSKKKGLFRRSLLSGLKLRKSESKSSLASQRSKQSSFRSEAGMSTVSSTASDIHSTISLGEAEAELAVIEDDIDATTTETYVGEWKNDKRSGFGVSQRSDGLKYEGEWASNRRHGYGCMTFPDGTKEEGKYKQNILVGGKRKNLIPLRASKIREKVDRAVEAAERAATIAKQKAEIAAS

Amino Acids from 3' Exons

GPTRASGSVACARATASGRASRMAWPRSSAHPGRPSTPCAASTPTARRCIPTPLRRWPAARPCPAGASCSWPTVTPRSSRARRRGCFGARCVGSCASRSPRAAWPANAASRAPFAARRAAPSAPRPATSTPPSAWARLRPSWRSSRTTSTPPPPRPTWASGRTTNAPASAASARTGSSTRASGPATGAMATAAPSRTAPRRRASTSRTSSSAASARTSSPCGPARSARRWTAPLRPLSGPPPSPSRRLRSRLP,DLPGPVGRWHAPGLRRPAERPVWHGRGHPLTPEDVHQLPAQRAHQRHGAASRRLSGGGRQPGRVPRGLRARGPQLRDPQEQEEGAVSALAAEWAEAAQVGVQEQPGQPTQQAELLSQRGGHEHRQLHGQRHPLHHQPGRGGRAGGHRGRHRRHHHRDLRGRVEERQTLRLRREPALGRAQVRGRVGQQPAPWLRLHDLPGRHQGGGQVQAEHPRRRQAQEPHPPAGQQDPREGGPRRGRAGRHHRQAEGDRGFQ,TYQGQWVGGMRQGYGVRQSVPYGMAAVIRSPLRTSINSLRSEHTNGTALHPDASPAVAGSPAVSRGGFVLVAHSDSEILKSKKKGLFRRSLLSGLKLRKSESKSSLASQRSKQSSFRSEAGMSTVSSTASDIHSTISLGEAEAELAVIEDDIDATTTETYVGEWKNDKRSGFGVSQRSDGLKYEGEWASNRRHGYGCMTFPDGTKEEGKYKQNILVGGKRKNLIPLRASKIREKVDRAVEAAERAATIAKQKAEIAAS