McDonnell Genome Institute

Washington University

CircRNA

chr16|87333885|87347250|-|FBXO31|ENST00000311635.11

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.999

10

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

13

2

Peptide

APGSPSQALPSPGQR

Amino Acids from 5' Exons

GDPNIPAGQQTVEIDLRHRIQLPDLENQRNFNELSRIVLEVRERVRQEQQEGGHEAGEGRGRQGPRESQPSPAQPRAEAPSKGPDGTPGEDGGEPGDAVAAAEQPAQCGQGQPFVLPVGVSSRNEDYPRTCRM,ATPTSPLGSRQWRSTGIGSSCPTSRTSATSMSSPASSWRCARGCARSSRKAGTRRARVVAGRAPGSPSQALPSPGQRRPARAQMGHLVRMVASLGMPLRPSSLPSVGRGSRSCCPWAAPGMRTTPEPAGC,RPQHPRWAADSGDRPEASDPAARPREPAQLQALPHRPGGAREGAPGAAGRRARGGRGSWPAGPPGVPAKPCPAQGRGAQQGPRWDTWGWWRAWGCRSCGRAACPVWAGAAVRAARGRELQEGLPPNLQDV

Amino Acids from 3' Exons

CFTDIDTFWDCGSQISGHTEDCTW,ASPITHFGIVAARYRAIRRTAERG,LHRYRHILGLWQPDIGPYGGLLNVV