McDonnell Genome Institute

Washington University

CircRNA

chr16|81121585|81128066|-|PKD1L2|ENST00000525539.5

Cancer

Type of Peptide

PRAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9281

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

16

Peptide

RHISTDAVHHIPWMLK

Amino Acids from 5' Exons

APFLRTRPCRASACTPSPTAGTPSWRQSSSTSSSSSTTWWC,HLFYARGPAEPPPVPLHRRLAPLRGSGRAHLLPLPPLLHGGA,TFFTHAALQSLRLYPFTDGWHPFVVAAELIYFLFLLYYMVVQ

Amino Acids from 3' Exons

ALSLMGTPSWLAVPRFVKGSRKALALLPSSRRHISTDAVHHIPWMLKTWQTMGKAGMPPPSVMAVPEPGPTSRVSHLGQTHCVPGRRLRGPLGDSPKHVK,LYHWELQAGWQCPDSSSEGPGKLLPSCPAAAGISQRMPCTIFPGCRHGRLWGRLECHHPQWQYQSQDQRQGYPIWGKLTVYRGGGYVVPLGTDRQSTS,FITDGNSKLVGSAQIRQVRVQESSCPLAQQPQAYLNGCRAPYSLDAEDMADYGEGWNATTLSNGSTRARTNVKGIPSGANSLCTGEEATWSPWGLIAKARQ