McDonnell Genome Institute

Washington University

CircRNA

chr16|75635679|75640349|-|KARS|ENST00000302445.7

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9954

32

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

10

6

Peptide

SFLDELGFLEQYYKIR

Amino Acids from 5' Exons

ETRYRQRYLDLILNDFVRQKFIIRSKIITYIRSFLDELGFLE,KQGIARDTWTSMTLGRNLSSALRSSHIEVSMSWDS,NKVSPEILGLDPELCEAEIYHPLDHHIYKKFLRAGIPR

Amino Acids from 3' Exons

QYYKIRSQAIHQLKVNGEDPYPHKFHVDISLTDFIQKYSHLQPGDHLTDITLKVA,NTTKSAVKQFISRSMGKTHTHTSSMTSHSLTSSKNIVTCSLGITLTSPRWQ,ILQNPQSSNSSAEGQWGRPIPTQVPCRHLTHLHPKISPAAWGSPDHHLKGG