McDonnell Genome Institute

Washington University

CircRNA

chr16|75411824|75412754|-|CFDP1|ENST00000283882.3

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9896

13

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

2

Peptide

VFDFAGEEVRK

Amino Acids from 5' Exons

KGEETEETSSSKLLVKAEELEKPKETEKVKITKVFDFAGEEV,KERRLKRQVQVNCWKQKSRNLKKQKKLKSPRCLILLVKK,RRGDRDKFKIVGKSRRARETRNRKSNHQGVFCWRSK

Amino Acids from 3' Exons

EEKTRWPLIRRRGRGGCQFRIGKQGGRRCRAGKRHWIRGCQEKEGGRTLGQLPQCGTKIKSAPKYTS,KRRQGGLSLEEEEEEDANSESEGSSSEEEDDAAEQEKGIGSEDARKKKEDELWASFLNDVGPKSKVPPSTQVK,REDKVASHKKRKRRMPIQNLREAVVRRKMTLQSRKKALDQRMPGKRRRTNSGPASSMMWDQNQKCPQVHKL