McDonnell Genome Institute

Washington University

CircRNA

chr16|75234888|75235986|-|BCAR1|ENST00000162330.9

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9955

32

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

20

Peptide

WWHMVRPSTLAGEALEPPLR

Amino Acids from 5' Exons

VYDVPPSVSKDVPDGPLLREETYDVPPAFAKAKPFDPARTPLVLAAPPPDSPPAEDVYDVPPPAPDLYDVPPGLRRPGPGTLYDVPRERVLPPEVADGGVVDSGVYAVPPPAEREAPAEGKRLSASSTGSTRSSQSASSLEVAGPGREPLELEVAVEALARLQQGVSATVAHLLDLAGSAGATGSWRSPSEPQEPLVQDLQAAVAAVQSAVHELLEFARSAVGNAAHTSDRALHAKLSRQLQKMEDVHQTLVAHGQALDAGRGGSGATLEDLDRLVACSRAVPEDAKQLASFLHGNASLLFRRTKATAPGPEGGGTLHPNPTDKTSSIQSRPLPSPPKFTSQDSPDGQYENSEGGWMEDYDYVHLQ,STTFLHRARMCPMAHCCVRRPTMCPPPSPRPSPLTRPAPHWYWLRPLQTPRRPRTCMTCRPRLLTSTTCPLACGGLARAPCTMCPVNGCFLLRWLMVAWSTVVCMRCLPQLNVKPRQRASACRPPAPAAHAAASLRPPWRWQGRAGNPWSWKLLWRPWHGCSRVAPPLPTFWTWQAAPVRLGAGVAPLSHRSRWCRTCRLLWPLSRVPSTSCWSLPAARWAMLPTHLTVPCMPSLAGSCRRWRTCTRRWWHMVRPSTLAGEALEPPLRTWTGWWPARGLCPRTPSSWPPSCTAMPHCSSDGPRPLPRGLRGVAPCTPTPLTRPAASSHDPCPHPLSSPPRTRQMGSTRTARGAGWRTMTTSTY,LRRSSIGEQGCARWPTAAGDLRCAPRLRQGQALPGPHPTGTGCAPSRLPAGRGRVRAAPGSPLRRAPWLAAAWPGHPVRCAPTGASSGGWWRGRQWCVCGASPSTSPGRGQAPVGLQHRQHTQQPVCVLLGGGRAGPGTPGAGSCCGGPGTAAAGCERHRCPPSGPGRQRRCDWELAPLATGAAGAGPAGCCGRCPECRPRAVGVCPQRGGQCCPHIPCPACQAPAAAEDGGRAPDAGGTWSGPRRWPGRLWSHPGPGPAGGLLAGCARGRQAAGLLPARQCLTALQTDQGHCPGAGGWHPAPQPHQDQQHPVTTPALTPVHLPGLARWAVREQRGGLDGGLLRPPT

Amino Acids from 3' Exons

VYDVPPSVSKDVPDGPLLREETYDVPPAFAKAKPFDPARTPLVLAAPPPDSPPAEDVYDVPPPAPDLYDVPPGLRRPGPGTLYDVPRERVLPPEVADGGVVDSGVYAVPPPAEREAPAEGKRLSASSTGSTRSSQSASSLEVAGPGREPLELEVAVEALARLQQGVSATVAHLLDLAGSAGATGSWRSPSEPQEPLVQDLQAAVAAVQSAVHELLEFARSAVGNAAHTSDRALHAKLSRQLQKMEDVHQTLVAHGQALDAGRGGSGATLEDLDRLVACSRAVPEDAKQLASFLHGNASLLFRRTKATAPGPEGGGTLHPNPTDKTSSIQSRPLPSPPKFTSQDSPDGQYENSEGGWMEDYDYVHLQ,STTFLHRARMCPMAHCCVRRPTMCPPPSPRPSPLTRPAPHWYWLRPLQTPRRPRTCMTCRPRLLTSTTCPLACGGLARAPCTMCPVNGCFLLRWLMVAWSTVVCMRCLPQLNVKPRQRASACRPPAPAAHAAASLRPPWRWQGRAGNPWSWKLLWRPWHGCSRVAPPLPTFWTWQAAPVRLGAGVAPLSHRSRWCRTCRLLWPLSRVPSTSCWSLPAARWAMLPTHLTVPCMPSLAGSCRRWRTCTRRWWHMVRPSTLAGEALEPPLRTWTGWWPARGLCPRTPSSWPPSCTAMPHCSSDGPRPLPRGLRGVAPCTPTPLTRPAASSHDPCPHPLSSPPRTRQMGSTRTARGAGWRTMTTSTY,LRRSSIGEQGCARWPTAAGDLRCAPRLRQGQALPGPHPTGTGCAPSRLPAGRGRVRAAPGSPLRRAPWLAAAWPGHPVRCAPTGASSGGWWRGRQWCVCGASPSTSPGRGQAPVGLQHRQHTQQPVCVLLGGGRAGPGTPGAGSCCGGPGTAAAGCERHRCPPSGPGRQRRCDWELAPLATGAAGAGPAGCCGRCPECRPRAVGVCPQRGGQCCPHIPCPACQAPAAAEDGGRAPDAGGTWSGPRRWPGRLWSHPGPGPAGGLLAGCARGRQAAGLLPARQCLTALQTDQGHCPGAGGWHPAPQPHQDQQHPVTTPALTPVHLPGLARWAVREQRGGLDGGLLRPPT