McDonnell Genome Institute

Washington University

CircRNA

chr16|75233845|75243090|-|BCAR1|ENST00000162330.9

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9993

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

15

5

Peptide

GSITRQGKSQLELQQNVLAK

Amino Acids from 5' Exons

GKEEFEKTQKELLEKGSITRQGKSQLELQQ,GRRSLRRPRRSCWKRAASRGRARASWSCS,EGGVEDPEGAAGKGQHHAAGQEPAGVAA

Amino Acids from 3' Exons

NVLAKALYDNVAESPDELSFRKGDIMTVLEQDTQGLDGWWLCSLHGRQGIVPGNRLKILVGMYDKKPAGPGPGPPATPAQPQPGLHAPAPPASQYTPMLPNTYQPQPDSVYLVPTPSKAQQGLYQVPGPSPQFQSPPAKQTSTFSKQTPHHPFPSPATDLYQVPPGPGGPAQDIYQVPPSAGMGHDIYQVPPSMDTRSWEGTKPPAK,TCWPKRSMTMWPSPRMSSPSARVTSRCWSRTRRAWTAGGSARCMGARASCLGTASRSWWACMIRSQQGLAPALPPPRPSLSLASMPQRLRPPSTRPCSPTPTSPSQTASTWCPLPARLSKASTKSRVPALSSSLPQPSRHPPSRSRHPITRFPARPQTCTRCPQGLEALPRIFTRCHLLPGWGMTSTRSPRPWTHAAGRARSPRQ,RAGQSALQCGRVPGALLPQGHHDGAGAGHAGPGRLVALLAAWAPGHRAWEPPQDLGGHVEASRAWPRPSRHPGPASAWPPCPSASGLPVHAHAPQHLPAPARQRLPGAHSQQGSARPLPSPGSQPSVPVSPSQADIHLLEADTPSPVSQPGHRPVPGAPRAWRPCPGYLPGATFCRDGAHLPGPPVHGHTQLGGHEAPGK