McDonnell Genome Institute

Washington University

CircRNA

chr16|74908907|74956610|-|WDR59|ENST00000262144.10

Cancer

Type of Peptide

PRAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9938

21

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

2

Peptide

AVSPTEPTPSR

Amino Acids from 5' Exons

VTWYISQGPQCIGRCLPQSLLR,LPGIFHKAHDNASGGVSHRAYSE,YLVYFTRPMTMHRAVSPTEPTP

Amino Acids from 3' Exons

PQILIHRQSRCPFRRSPKDLSPEQMGHWSCAVESSQLCTLFCGF,RRFLYIVNLDAPFEGHRKISRQSKWDIGAVQWNPHDSFAHYFAAS,ADSYTSSIMPLSKVTERSLARANGTLELCSGILMTALHTILRL