McDonnell Genome Institute

Washington University

CircRNA

chr16|74885652|74942826|-|WDR59|ENST00000262144.10

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9916

9

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

6

Peptide

GIAGASQVK

Amino Acids from 5' Exons

APGPRQYPAILEMLWGNPLPLGSEREASSVEVCLLSSPSQRD,LLDPANTQQFDDFKKCYGEILYRWGLREKRAEVLKFVSCPPDPHKGI,SWTPPIPSNLMTLRNAMGKSSTVGVERSELKCSLSPVLLTLTKGS

Amino Acids from 3' Exons

RVPPRSNGIKKMLTALPPAMTAMCGYGIR,GCLPGQMEKKCLPCHQPRRCADMGE,GASQVKWNKKNANCLATSHDGDVRIWDKR