McDonnell Genome Institute

Washington University

CircRNA

chr16|74685485|74695759|-|MLKL|ENST00000308807.11

Cancer

Type of Peptide

BRCA-Luminal A

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9497

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

10

5

Peptide

IFGICIDETGMENLK

Amino Acids from 5' Exons

NSEADFQGDQNHEEIRISQHPAYIWDLHN,IVRQTFNKEIKTMKKFESPNILRIFGICIDET,GRLSIRRSKPRNSNLPTSCVYLGFALMKQ

Amino Acids from 3' Exons

AWKISILSPLARSSTNGVKRNTARNSAGAWATASSASSLWRCSRTKERGACPLRSPQPTASRLPWRRLMGRKSSAIDPISAGFQQARTKYSSRTTGSVMSGRSSRCYFRLSNACLFHPAKERPGHRKISRMQTKTGELSRCEE,HGKFEAYYHPWPGHPQTVRDEILQETVPAPGPPRPRPDQASGDAPGPRKEERALEVNHSHEPLQGCPGGGWGDRKVQQIQYLQVSNSKPGQNTLQGREQEAECLEGALAVTSGATHACFTHKPRSVLGTGRSAGCRRRQASFPDAKK,MENLKHIITLGQVIHKRCEEMKYCKKQCRRLGHRVLGLIKPLEMLQDQGKRSVPSEKLTTAMNRFKAALEEANGEIEKFSNRSNICRFLTASQDKILFKDVNRKLSDVWKELSLLLQVEQRMPVSPISQGASWAQEDQQDADEDRRAFQMLRR