McDonnell Genome Institute

Washington University

CircRNA

chr16|74480240|74480394|-|GLG1|ENST00000205061.9

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9872

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

9

Peptide

RFSSLPHPR

Amino Acids from 5' Exons

AGPCPVPQVPGRRFSSLPHPRLEDQIYASGSCVLLFIQTRLPHGTGKE,LDPVLYRKCQGDASRLCHTHGWNETSEFMPQGAVFSCLYRHAYRTEEQGRR,WTLSCTASARETLLVFATPTVGMRPVNLCLRELCSLVYTDTPTALRNREG

Amino Acids from 3' Exons

AGPCPVPQVPGRRFSSLPHPRLEDQIYASGSCVLLFIQTRLPHGTGKE,LDPVLYRKCQGDASRLCHTHGWNETSEFMPQGAVFSCLYRHAYRTEEQGRR,WTLSCTASARETLLVFATPTVGMRPVNLCLRELCSLVYTDTPTALRNREG