McDonnell Genome Institute

Washington University

CircRNA

chr16|74465675|74474632|-|GLG1|ENST00000205061.9

Cancer

Type of Peptide

PRAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

17

Peptide

QMIKELECLQDHLDDLVVECR

Amino Acids from 5' Exons

IIECLKENKKQLSTRCHQKVFKLQETEMMDPELDYTLMRVCKQMIK,LSNVKKTRSSAPAATKKYLSCRRQRWTQSTTPSGSASR,YRMSERKQEAAKHPLPPKSIAAGDRDDGPRARLHPHEGLQADDK

Amino Acids from 3' Exons

ELECLQDHLDDLVVECRDIVGNLTELESE,SWSAFRTIWMTWWWSVEILATSLSNQ,AGVPSGPSGLGGGVRYSWQPHVRIR