McDonnell Genome Institute

Washington University

CircRNA

chr16|71922473|71924817|+|IST1|ENST00000329908.12

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

18

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

38

2

Peptide

GGSGGFTAPVGGPDGTVPMPMPMPMPMPSANTPFSYPLPK

Amino Acids from 5' Exons

AEAPPGVETDLIDVGFTDDVKKGGPGRGGSGGFTAPVGGPDGTVPMPMPMPMPMPSANTPFSYPLPKGP,QKLLLGRQILLMLDSQMMRKEALEEEGVVASQHQLVDLMERCQCPCPCPCLCHLQIRLSHIHCQRD,RSSSWGRDRSYCWIHRCEERRPWKRREWWLHSTSWWTWNGANAHAHAHAYAICKYAFLISTAKGT

Amino Acids from 3' Exons

MTLMLIRISLLHRLL,HCEYLFCTDC,DINADKNISSAQIV