McDonnell Genome Institute

Washington University

CircRNA

chr16|70544437|70557029|+|SF3B3|ENST00000302516.9

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

7

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

18

20

Peptide

QDELGERGSIGFLYLNIGLQIADLANEDTPQLYVACGR

Amino Acids from 5' Exons

IADLANEDTPQLYVACGRGPRSSLRVLRHGLE,LIWPMKILHSCMWPVVGDPDHLESDMDL,SSGQRYSTVVCGLWGTPIISESPKTWT

Amino Acids from 3' Exons

DCLQPLSMQALPAQPESLCIVEMGGTEKQDELGERGSIGFLYLNIGLQ,TVCNLACRLSQPSLSPCVSWKWVGLRSRMSWVRGARLASYTILGY,LFATSKHAGSPSPAVLVYRGNGWDEAGAGEGLDWLPIPEYWAT