McDonnell Genome Institute

Washington University

CircRNA

chr16|70539103|70541834|+|SF3B3|ENST00000302516.9

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.976

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

18

Peptide

NLVLVDELDSLSPILFCQVTEIR

Amino Acids from 5' Exons

VTEIRLKYFDTVPVAAAMCVLKTGFLFVASEFGN,LLRSGSNILILYPLLLPCVCLKQGSFLHQNLET,YDPAQIFYCTRCCCHVCANRVPFCSIRIWKP

Amino Acids from 3' Exons

LLISNCTSWRRTVFISHASGRRRHILFSAKTTKPCAGVGQPLSHSVLP,YLYQIAHLGDDDEEPEFSSAMPLEEGDTFFFQPRPLKNLVLVDELDSLSPILFCQ,TYIKLHILEMMMKNLSFHQPCLWKKETHSFFSQDHLKTLCWLMSWTASLPFCFA