McDonnell Genome Institute

Washington University

CircRNA

chr16|70269617|70270340|-|AARS|ENST00000261772.12

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9157

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

11

Peptide

GEADGILKPLPK

Amino Acids from 5' Exons

GTGARPYTGKVGAEDADGIDMAYRVLADHARTITVALADGGRPDNTGR,AQVPDHTLGKLVLRMPMGLTWPTGCWLTTLGPSLWHWLMVAGLTTQGV,HRCPTIHWESWCGCRWDHGLPGAGPRSDHHCGTGWWPAQHRAW

Amino Acids from 3' Exons

GSWHSETSSQEKHHRDGPGTTGICAAEDVQLHPFCPLLSHSE,EADGILKPLPKKSIDTGMGLERLVSVLQNKMSNYDTDLFVPYFEAIQK,KLMAFNLFPRKALTQGWAWNDWYLCCRIRCPTMTLTFLSLTLKPFR