McDonnell Genome Institute

Washington University

CircRNA

chr16|70258979|70261157|-|AARS|ENST00000261772.12

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.938

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

12

2

Peptide

AEEIANEMIEAAKK

Amino Acids from 5' Exons

PRRRPIMSNHTATHILNFALRSVLGEADQKGSLVAPDRLRFDFTAKGAMSTQQIKKAEEIANEMIEAAK,PDEDPSATTQLRTFTSPCAQCLGKLTRKAHWLLLTASDLTLLPREPCPPNRSRRLKRLLMRLRQP,PTKTHHEQPHSYAHSELRPALSAWGSPERLIGCSPPQILYCQGSHVHPTDQEGRDCDDGSQ

Amino Acids from 3' Exons

KTEFTVKNAQVRGGYVLHIGTIYGDLKVGDQVWLFIDE,KQSLQRMLRSEEGMCYTLEPSTVTKWGIRSGCLLM,NRVYSEECSGPRRVCATHWNHLRPESGGSGLAVY