McDonnell Genome Institute

Washington University

CircRNA

chr16|70258032|70259186|-|AARS|ENST00000261772.12

Cancer

Type of Peptide

BRCA-Luminal A

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9812

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

3

Peptide

LWGNPRR

Amino Acids from 5' Exons

AVYTQDCPLAAAKAIQGLRAVFDETYPDPVRVVSIGVPVSELLDDPSGPAGSLTSVEFCGG,PSIPRIAPWQQRKPSRAYGLCLMRPILTLCESSPLGSRCPSCWMTPLGLLAPLLLSSVGE,RLYPGLPPGSSESHPGPTGCVDLSPCASRLHWGPGVRVAGPLWACWLPDFCVLWGN

Amino Acids from 3' Exons

PRRRPIMSNHTATHILNFALRSVLGEADQKGSLVAPDRLRFDFTAKGAMSTQQIKKAEEIANEMIEAAK,PDEDPSATTQLRTFTSPCAQCLGKLTRKAHWLLLTASDLTLLPREPCPPNRSRRLKRLLMRLRQP,PTKTHHEQPHSYAHSELRPALSAWGSPERLIGCSPPQILYCQGSHVHPTDQEGRDCDDGSQ