McDonnell Genome Institute

Washington University

CircRNA

chr16|69931151|69931890|+|WWP2|ENST00000568818.1

Cancer

Type of Peptide

BRCA-HER2-enriched

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9508

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

12

Peptide

LSLPPLPAVEGR

Amino Acids from 5' Exons

DEARFPWCLPQFSVEVSPVPFPLP,TKQGSPGAYDRSFRWKYHQFRFLCH,RSKVPLVLMTAVFGGSITSSVSSA

Amino Acids from 3' Exons

SNALPSHVKISVSRQTLFEDSFQQVRSWCPKPVAGRRPPPSTPSPIAWPVKPTLQTFQGVSLGDCVCWILGLRVPCPSRPCLLWKGEWQAGPMLCLPRSTNPMTCAAGSTSSCVARRAWTMGASP,QMPYLATRSAFPGRRFSKIPSNRLDHGARNQWQADALLPAPHLLSRGLLNPHCRLSRAVLVTVSAGYWALESPVPPAPACCGRESGRLARCSVFPDHEHETLPAPPALHHHAWRGGPGLWGHRQ,KCPTPREDQRFQADAFRRFLPTGIMVPETSGRPTPSSQHPISYRVACTHTADFPGRESWLCLLDIGPSPLSLPPLPAVEGRVAGWPDALSSQIMNMKPYDLRRRLYIIMRGEEGLDYGGIA