McDonnell Genome Institute

Washington University

CircRNA

chr16|69684886|69694239|+|NFAT5|ENST00000349945.5

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9192

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

9

Peptide

CSLQCFTLK

Amino Acids from 5' Exons

QQLVLMMRRKYLVQQDLALLKRPK,SSWCFECKCEEGNISSKTLLFRGHE,AAGALNVNVKKEISSPARPCSFEEAMK

Amino Acids from 3' Exons

TTKSVGSTQQTLENISNIAGNGSFSSPSSSHLPSENEKQQQIQPKAYNPETLTTIQTQDISQPGTFPAVSASSQLPNSDALLQQATQFQTRETQSREILQSDGTVVNLSQLTEASQQQQQSPLQEQAQTLQQQISSNIFPSPNSVSQLQNTIQQLQAGSFTGSTASGSSGSVDLVQQVLEAQQQLSSVLFSAPDGNENVQEQLSADIFQQVSQIQSGVSPGMFSSTEPTVHTRPDNLLPGRAESVHPQSENTLSNQQQQQQQQQQVMESSAAMVMEMQQSICQAAAQIQSELFPSTASANGNLQQSPVYQQTSHMMSALSTNEDMQMQCELFSSPPAVSGNETSTTTTQQVATPGTTMFQTSSSGDGEETGTQAKQIQNSVFQTMVQMQHSGDNQPQVNLFSSTKSMMSVQNSGTQQQGNGLFQQGNEMMSLQSGNFLQQSSHSQAQLFHPQNPIADAQNLSQETQGSLFHSPNPIVHSQTSTTSSEQMQPPMFHSQSTIAVLQGSSVPQDQQSTNIFLSQSPMNNLQTNTVAQEAFFAAPNSISPLQSTSNSEQQAAFQQQAPISHIQTPMLSQEQAQPPQQGLFQPQVALGSLPPNPMPQSQQGTMFQSQHSIVAMQSNSPSQEQQQQQQQQQQQQQQQQQSILFSNQNTMATMASPKQPPPNMIFNPNQNPMANQEQQNQSIFHQQSNMAPMNQEQQPMQFQSQSTVSSLQNPGPTQSESSQTPLFHSSPQIQLVQGSPSSQEQQVTLFLSPASMSALQTSINQQDMQQSPLYSPQNNMPGIQGATSSPQPQATLFHNTAGGTMNQLQNSPGSSQQTSGMFLFGIQN,LQSLLDQLSKHKTSQTQEMALFHHHHLPTYLLKMKNSSRFSPRHTTQRPQLFKPRTSHSLVLFQQFLLLVSCPTAMHYCSRLHSFRQEKLSLERYYSQMVQWLICHNLRHHNNSSSHHYKNKHRLYSSRFHQIFFHHQIVVSFRILFSSCKQGVSQAVLLVAAVEVLTWSNKFRHSSSYLQFYFLLQMVMRMFKSSLVQIFFNKSVKFRVVALECFPQQSQQSIPDQIIYYLEELKVFIHSLKTRYLINSSSSSSNSKWNLQPQWWRCNRVSARQLPRFSQSYSLQLLQQMETFSNRQFTSRLLTVHCLPMRICKCSVNCFLLLLQFLEMKLLQLPHSRLQPLALPCFRHQVQEMEKKLEHKQNRFRTVSFRPWSKCNIVGTINLKLTFFHPQKVVFRIVVPNNKVMVYSSKGMRCHFNLEIFCSSLLIHRPNFFILKILLPMLRTFPRKLKVLSFIVQILLSTVRLLQPPLNKCSLQCFTLKVPLLCYRALQFLKTSSQPTYFFPRVPIIFRLTQPKKHFLQHRTQFLHFSQHQTVNNKLLSNSKLQYHTSRLLCFPKNRHNPRSRVYFSLRWPWAPFHLIQCLKANKEPCSSHSTQLPCRVTLHPRNSSSSSNSSSNSSSNNNRAFYSVIRIPWLQWRLQSNHHQTYSTQIKIQWLIRSNRTSQFFTNKVTWPQIKSNSPCNFRVSPQFPHFRTQVLPSRNHHRPPCSIALLRFSWYKGHLVLKSSKLSSYLQHPCLPCRPVINKICNSLLFIPLRTTCLEFKEPHLRLNHRLLYFTTQQEAQTNCRILLAHLSRHQECSYLAFKI,YKVCWINSANIRKHLKHSRKWLFFITIIFPPTFKKTAADSAQGIQPRDPDNYSNPGHLTAWYFSSSFCFSAAQQRCTIAAGYTVSDKRNSVRDITVRWYSGFVTTDGITTTAAVTTTRTSTDFTAADFIKYFSITKCESASEYYSAAASREFHRQYCWQQWKCLGPTSFRGTAAVIFSFIFCSRWECSRAACRYFSTSQSNSEWCKPWNVFLNRANSPYQTRFITWKSKCSSTVKHVISTAAAAAATASDGIFSRNGDGDATEYLPGSCPDSVRVIPFNCFSKWKPSAIASLPADFSHDECIVYQGYANAVIVFFSSCSFWKNFYNYHTAGCNPWHYHVSDIKFRRWRRNWNTSKTDSEQCLSDHGPNATWGQSTSSPFFIHKKYDECSEWYPTTRWFIPAREDDVTSIWKFFAAVFSFTGPTFSSSKSYCRCSEPFPGNSRFSLSSKSYCPQSDFYNLLTNAASNVSLSKYHCCVTGLFSSSRPAVNQHISFPESHESSDHSSPRSIFCSTELNFSTSVNIKQTTSCFPTASSNITHPDSYAFPRTGTTPAAGFISASGGPGLPSTSNASKPTRNHVPVTALNSCHAELSIPGTAAAAATAAATAAATTTEHFIQSEYHGYNGVSKATTTKHDIQPKSKSNGSGATEPVNFSPTKHGPNESRATAHAISESVHSFLTSEPRSYPVGIITDPLVPLSSDSVGTRVTFSRAASNSLLISSIHVCLADQYKSTRYATVSSLFPSEQHAWNSRSHIFASTTGYFISQHSRRHNEPTAEFSWLISADIRNVLIWHSK