McDonnell Genome Institute

Washington University

CircRNA

chr16|69235747|69245815|+|SNTB2|ENST00000524887.5

Cancer

Type of Peptide

OSCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9539

79

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

15

Peptide

MCFAARNLSMPDLENRPIMR

Amino Acids from 5' Exons

AYNEEISVPISGAHQLLYVSSNILEL,PIMRKFLSDQYQGHISCCTKFLQISWNC,LGNFCLTNIRGTSAAVLSFFKYPGIV

Amino Acids from 3' Exons

SSSSEKHHISRSHHYQICRGKVQPPSHQALVAVRTLVRQNTRTAPRTGRSSLSKCALLLETACRIWKT,QVHPRSNTIYQEAIISIRSAVGRCSPPVTKLWQGLWFAKTPEQHQGQEDHPSQNVLCCKPKHAGSGKQ,KFIREVTPYIKKPSLVSDLPWEGAAPQSPSFSGSEDSGSPKHQNSTKDRKIIPLKMCFAARNLSMPDLEN