McDonnell Genome Institute

Washington University

CircRNA

chr16|69136695|69167185|+|CIRH1A|ENST00000314423.11

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9692

75

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

15

Peptide

MNQMSSGGAQLMLLK

Amino Acids from 5' Exons

FFPGHESRATEALCWAEGQRLFSAGLNGEIMEYDLQALNIKYAMDAFGGPIWSMAASPSGSQLL,FSQVMSLGLQKLCAGQKDSDSLVLGSMARLWSMIYRRTSSMLWMPLEDLFGAWLPAPVALNF,FPRSVSGYRSFVLGRRTATLCWAQWRDYGVFTGVKHQVCYGCLWRTYLEHGCQPQWLSTF

Amino Acids from 3' Exons

PLPNDKTLLYNPFPPTNESDVIRRRTAHAFKISKIYK,PFQMTKPYSTIHFLPRMNQMSSGGAQLMLLKFLRYI,PSKQNLTLQSISSHEIRCHPEAHSSCFNFDI