McDonnell Genome Institute

Washington University

CircRNA

chr16|69133457|69139914|+|CIRH1A|ENST00000314423.11

Cancer

Type of Peptide

PRAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9486

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

2

Peptide

SGMGEFK

Amino Acids from 5' Exons

EWVNLRSIEYVSLIMFHQESAVWLTITSQTDWLFHEQMALWKFITCQQTTFRR,NGIGPSSTFLLCSIRNPLCGLQPVKQIGCFTNRWHCGNLLVSKLLSGE,MGEFKVHRVRFFNYVPSGIRCVAYNNQSNRLAVSRTDGTVEIYNLSANYFQEK

Amino Acids from 3' Exons

VASVSAGIPLVPTLQLVPTTLVCLMSNQ,SHPESQLASLWYPHCSWFHRLHCVCQI,RILSLSWHPSGTHIAAGSIDYISVFDVKS