McDonnell Genome Institute

Washington University

CircRNA

chr16|68038005|68071108|+|DUS2|ENST00000358896.10

Cancer

Type of Peptide

OSCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9901

74

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

18

2

Peptide

YAVTEEEMILNSLSLCYHNK

Amino Acids from 5' Exons

AVTEEEMILNSLSLCYHNKLILAPMVRVGTLPMRLLALDYGADIVYCE,LQRRKFIASLCVTIISSWPQWFGGLFQGCWPWIMERTLFTV,CNRGGNDFEPLSVLPANPGPNGSGRDSSNEAAGPGLWSGHCLL

Amino Acids from 3' Exons

RRISPHPTVFGHRGLSTSHGSLFRDGGPSSHVEPIYLPQGGSAAPGGGHAEIHQI,GGSHDHIQQYSDIEDFRQATAASSVMVARAAMWNPSIFLKEGLRPLEEVMQKYIRY,EDLMTTSNSIRTRTFDKPRQPLPWWPEQPCGTHLSSSRRVCGPWRRSCRNTSD