McDonnell Genome Institute

Washington University

CircRNA

chr16|67685456|67685802|-|GFOD2|ENST00000268797.11

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9869

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

10

Peptide

IISMPEALVR

Amino Acids from 5' Exons

EPCLTRTFGRSYPCQRLLGDELVKREAGMKMLPGVGVFGTGSSARVLVPLLRAEGFTVEALWGKTEEEAKQLAEEMNIAFYTSRTDDILLHQDVDLVCISIPPPLTRQISVKAL,SHVPGRLEDHIHARGSCEEMSWRERLGRCCQEWACLGLAAPPEFWSHCGQKGSLLRPCGGRLRRRRSSLLRRTSPSTPAGLMTSCCIKMWIWCASASPLHSPGRYPRL,AMSDQDVWKIISMPEALVRRVGKERGWDEDAARSGRVWDWQLRPSSGPTAEGRRVHCGPVGEDGGGEAACGDEHRLLHQPDHLAASRCGSGVHQHPPSTHPADIREGS

Amino Acids from 3' Exons

EPCLTRTFGRSYPCQRLLGDELVKREAGMKMLPGVGVFGTGSSARVLVPLLRAEGFTVEALWGKTEEEAKQLAEEMNIAFYTSRTDDILLHQDVDLVCISIPPPLTRQISVKAL,SHVPGRLEDHIHARGSCEEMSWRERLGRCCQEWACLGLAAPPEFWSHCGQKGSLLRPCGGRLRRRRSSLLRRTSPSTPAGLMTSCCIKMWIWCASASPLHSPGRYPRL,AMSDQDVWKIISMPEALVRRVGKERGWDEDAARSGRVWDWQLRPSSGPTAEGRRVHCGPVGEDGGGEAACGDEHRLLHQPDHLAASRCGSGVHQHPPSTHPADIREGS