McDonnell Genome Institute

Washington University

CircRNA

chr16|66769962|66770309|-|CCDC79|ENST00000313294.7

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.999

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

6

Peptide

NFVSQSRK

Amino Acids from 5' Exons

EEIQRENYQDNISSMNISIQNTWKHLHADRIGRGSKAEDEDKSHSRQLQSYKSHGVMSKACTNDDQMKTPLKSANPVHACYRESEQNKTLYKAKSSCNQNLHEETTFEKNFVSQS,KKYKEKTIRIIFHLTVFRIHGNISMQIGLVEVAKQKMRIKAILDSYRVISPMESCLKHVQMMTKRHRRAQIQSMLVTGRVSKIRLYIKPSQAAIKTYMKKLLLKRILFLNQ,RNTKRKLSGYFIYEHKYSEYMETSPCRSDWSRQSRRGKPFTVTELVPWSHVSMYKPNEDTVKERKSSPCLLQGEAKDFISQVKLQSKLTRNYFKEFCFSIK

Amino Acids from 3' Exons

EEIQRENYQDNISSMNISIQNTWKHLHADRIGRGSKAEDEDKSHSRQLQSYKSHGVMSKACTNDDQMKTPLKSANPVHACYRESEQNKTLYKAKSSCNQNLHEETTFEKNFVSQS,KKYKEKTIRIIFHLTVFRIHGNISMQIGLVEVAKQKMRIKAILDSYRVISPMESCLKHVQMMTKRHRRAQIQSMLVTGRVSKIRLYIKPSQAAIKTYMKKLLLKRILFLNQ,RNTKRKLSGYFIYEHKYSEYMETSPCRSDWSRQSRRGKPFTVTELVPWSHVSMYKPNEDTVKERKSSPCLLQGEAKDFISQVKLQSKLTRNYFKEFCFSIK